SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028732 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028732
Domain Number 1 Region: 213-374,412-474
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 477-664
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-41
Family cAMP-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 37-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-17
Family Flavin-binding PAS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028732   Gene: ENSGGOG00000034807   Transcript: ENSGGOT00000041111
Sequence length 988
Comment pep:known_by_projection chromosome:gorGor3.1:14:43662981:44005194:-1 gene:ENSGGOG00000034807 transcript:ENSGGOT00000041111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
DEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSF
SRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTLSIPVDHPVRKLFQKFKQQKELR
NQGSTQGDPERNQLQVESRSLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRD
AMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLL
SEDPKSSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPIQADAKHPFYP
IPEQALQTTLQEVKHELKEDIQLLSCRMTALEKQVAEILKILSEKSVPQASSPKSQMPLQ
VPPQIPCQDIFSVSRPESPESDKDEIHF
Download sequence
Identical sequences A0A2J8WLN9 G3SKT9 Q8NCM2
ENSP00000321427 ENSGGOP00000028732 ENSGGOP00000028732 gi|22024390|ref|NP_647479.2| ENSP00000321427 9606.ENSP00000321427 NP_647479.2.87134 NP_647479.2.92137 XP_018864883.1.27298 ENSP00000321427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]