SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000018 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000018
Domain Number 1 Region: 55-115
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 590-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 645-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 729-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 771-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 10 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 11 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 12 Region: 205-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 13 Region: 692-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000209
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000018   Gene: ENSGGOG00000000019   Transcript: ENSGGOT00000000019
Sequence length 836
Comment pep:known_by_projection chromosome:gorGor3.1:19:37405945:37425850:1 gene:ENSGGOG00000000019 transcript:ENSGGOT00000000019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVDPPLHGPPNDFLIFQIIPLHSLSIMPRFLWILCFSMEETQGELTSSCGSKTMANVSL
AFRDVSIDLSQEEWECLDAVQRDLYKDVMLENYSNLVSLGYTIPKPDVITLLEQEKEPWI
VMREGTRNWFTDLEYKYITKNLLSEKNVCKIYLSQLQTGEKSKNTIHEDTIFRNGLQCKH
EFERQERHQMGCVSQMLIQKQISHPLHPKIHAREKSYECKECRKAFRQQSYLIQHLRIHT
GERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKP
YECKECGKAFSRVRDLRVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECK
VCGKTFRVQRHVSQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGK
SFSFHAELARHHRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFIC
GYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFRLQAEL
TRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYVCKECGKIFSRRYNLTQHF
KIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLMQHHRIHT
GEKPYECKECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGEIP
YECKECGKTFSRRYHLTQHFRLHTGEKPYSCKECGNAFRLQAELTRHHIVHTGEKPYKCK
ECGKAFSVNSELTRHHRIHTGEKPYKCKECGKAFIRSDQLTLHQRNHISEEVLCIM
Download sequence
Identical sequences G3QCS3
XP_004060781.1.27298 ENSGGOP00000000018 ENSGGOP00000000018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]