SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000037 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000037
Domain Number 1 Region: 547-802
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 246-476
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 2-207
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-41
Family YWTD domain 0.00000644
Further Details:      
 
Domain Number 4 Region: 849-1106
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-37
Family YWTD domain 0.0000779
Further Details:      
 
Domain Number 5 Region: 1237-1273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1199-1235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1159-1197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 502-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 805-852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 201-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000623
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1116-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000037   Gene: ENSGGOG00000000038   Transcript: ENSGGOT00000000038
Sequence length 1517
Comment pep:known_by_projection chromosome:gorGor3.1:11:65299833:65403395:1 gene:ENSGGOG00000000038 transcript:ENSGGOT00000000038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTY
LNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLD
QPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW
ADAKLSFIHRANLDGSFHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKA
GAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIR
RAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDL
DEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLY
WGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASR
DVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMK
TCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKT
ISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWR
DLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRL
YWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRN
RTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSS
RNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQ
NIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAM
GVVLHGDRDKPRAIIVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALV
VDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIE
RVEKTTGDKRTRIQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRC
SCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVC
SAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSF
PDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGA
NGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGRVPLYDRNHV
TGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAP
PTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATER
SYFHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSGGOP00000000037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]