SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001658 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001658
Domain Number 1 Region: 47-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 103-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 2-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001658   Gene: ENSGGOG00000013283   Transcript: ENSGGOT00000001694
Sequence length 161
Comment pep:known_by_projection chromosome:gorGor3.1:7:62344013:62346995:1 gene:ENSGGOG00000013283 transcript:ENSGGOT00000001694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLTFRDVKIEFSLEEWQCLDTAQRNLYRDVMLENYRNLVFLECGKAFNWSSTLTKHKII
HTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCEECGKAFNRSSTLTKHKRIHTEE
KPYKCEECGKAFNQFSILNKHKRIHMEEKPYKCEECGKSFR
Download sequence
Identical sequences ENSGGOP00000001658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]