SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001818
Domain Number 1 Region: 15-209
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.4e-45
Family Ribosomal protein L1 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001818   Gene: ENSGGOG00000001845   Transcript: ENSGGOT00000001856
Sequence length 209
Comment pep:novel chromosome:gorGor3.1:5:122160830:122161635:1 gene:ENSGGOG00000001845 transcript:ENSGGOT00000001856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSNKVDLIQEAVREVLDRNQSKCQKLLGTVELQISLKNSDPQKDERFLGTVLKSTRRPRF
STCVLGDQQHWVEAKPVGISYVDIEVLKKLDRNTKLLNKYDAFLASGSLIKQIPQILGPG
LNKEGRFPSLLMYSEDMVAKVDEGKSTIKFQVKKGLCLAALGRVKMTDDELVYNVHLAVN
FLVSLLRKNWQNIWALHIKNTIGKPQCLY
Download sequence
Identical sequences ENSGGOP00000001818 ENSGGOP00000001818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]