SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002005 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002005
Domain Number 1 Region: 663-1015
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.48e-54
Family Ankyrin repeat 0.0000603
Further Details:      
 
Domain Number 2 Region: 156-344,409-451,550-616
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.15e-48
Family Ankyrin repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 1040-1099
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.54e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00054
Further Details:      
 
Domain Number 4 Region: 4-92
Classification Level Classification E-value
Superfamily POZ domain 1.78e-17
Family BTB/POZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 361-504
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000787
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002005   Gene: ENSGGOG00000002030   Transcript: ENSGGOT00000002047
Sequence length 1105
Comment pep:known_by_projection chromosome:gorGor3.1:17:4211553:4343944:-1 gene:ENSGGOG00000002030 transcript:ENSGGOT00000002047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDE
LEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNY
CAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIEMDSQL
PGKLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSGWSLLHKGIQRGDLFAA
TFLIKNGALVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDS
KGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSVNPFED
VPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATNGAHVN
HRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADSVHLQT
PLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMHTIA
AQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVSRTQDGETALQLAIR
NQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPGPGGC
LQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASWGLEE
TVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLTPFACA
MTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDA
SKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVD
FAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAI
FDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQ
VATKQLLFRLLDMLSKEPPWCDGSYCYECTAKFGVTTRKHHCRHCGRLLCHKCSTKEIPI
IKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences ENSGGOP00000002005 ENSGGOP00000020138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]