SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002080 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002080
Domain Number 1 Region: 152-245
Classification Level Classification E-value
Superfamily TAFH domain-like 3.92e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 439-486
Classification Level Classification E-value
Superfamily Histone-fold 2.34e-17
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002080   Gene: ENSGGOG00000002111   Transcript: ENSGGOT00000002125
Sequence length 652
Comment pep:known_by_projection chromosome:gorGor3.1:20:60269513:60366867:-1 gene:ENSGGOG00000002111 transcript:ENSGGOT00000002125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPA
TPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLG
GAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQS
TETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAA
FIQQSQQQPPPPASQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVG
KQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPV
VKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARIL
ATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNL
VEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSR
SRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSG
PGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSGGOP00000002080 ENSGGOP00000002080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]