SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002259 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002259
Domain Number 1 Region: 297-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.75e-76
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 174-281
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000401
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000305
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002259   Gene: ENSGGOG00000002294   Transcript: ENSGGOT00000002309
Sequence length 560
Comment pep:known_by_projection chromosome:gorGor3.1:10:127469632:127506283:1 gene:ENSGGOG00000002294 transcript:ENSGGOT00000002309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPNQYDYSYEDYNQEENTSSTLT
HPENPDWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPYYRCVCKHPYTGPSCSRVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLLGFDS
CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTVSMPQGHFCGGTLIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSR
QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYIYGIVSWGLECGKRPGVY
TQVTKFLNWIKATIKSESGF
Download sequence
Identical sequences G3QIP4
ENSGGOP00000002259 XP_004050163.1.27298 XP_018890824.1.27298 ENSGGOP00000002259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]