SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002965 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002965
Domain Number 1 Region: 135-301
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.81e-28
Family Toll/Interleukin receptor TIR domain 0.00073
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000179
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002965   Gene: ENSGGOG00000003017   Transcript: ENSGGOT00000003031
Sequence length 436
Comment pep:known_by_projection chromosome:gorGor3.1:X:30294546:30335654:1 gene:ENSGGOG00000003017 transcript:ENSGGOT00000003031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLI
VDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVELAGGLGAILLLLVCLVTIYKC
YKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWNQETGEEERFALEILPDMLEK
HYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRRGWSIFELETRLRNML
VTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEMP
FKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTALATAHPDLRSTFHNTYHSQMR
QKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHTNSA
ILPLLPRETSISSVIW
Download sequence
Identical sequences XP_008539679.1.77740 XP_011826092.1.47321 ENSGGOP00000002965 ENSGGOP00000002965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]