SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003974 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003974
Domain Number 1 Region: 105-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.54e-18
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 658-724
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000774
Family VWC domain 0.0046
Further Details:      
 
Domain Number 3 Region: 473-541
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000146
Family VWC domain 0.022
Further Details:      
 
Domain Number 4 Region: 608-667
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000167
Family VWC domain 0.0066
Further Details:      
 
Domain Number 5 Region: 364-421
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000617
Family VWC domain 0.026
Further Details:      
 
Domain Number 6 Region: 547-605
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000188
Family VWC domain 0.011
Further Details:      
 
Domain Number 7 Region: 414-475
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000046
Family VWC domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003974   Gene: ENSGGOG00000004043   Transcript: ENSGGOT00000004071
Sequence length 935
Comment pep:known_by_projection chromosome:gorGor3.1:11:58001192:58040479:-1 gene:ENSGGOG00000004043 transcript:ENSGGOT00000004071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGYTGRKPPGHFAAERRRLGPHVCLSGFGSGCCPGWAPSMGGGHCTLPLCSFGCGSGIC
IAPNVCSCQDGEQGATCPETHRPCGEYGCDLTCNHGGCQEVARVCPVGFSMTETAVGIRC
TDIDECVTSSCEGHCVNTEGGFVCECGPGMQLSADRHSCQDTDECLGTPCQQRCKNSIGS
YKCSCRTGFHLHGNRHSCVDVNECRRPLERRVCHHSCHNTVGSFLCTCRPGFRLRADRVS
CEAFPKAVLAPSAILQPRQHPSKLLLLLPEAGRPALSPGHSPPSGAPGPPAGVRTTRLPS
PTPRLPTSSPSAPVWLLSTLMATPVPTASLLGNLRPPSLLQGEVMGTPSSPRGPESPRLA
AGPSPCWHLGAMHESRSRWTEPGCSQCWCEDGKVTCEKVRCEAACSHPIPSRDGGCCPSC
TGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCVSPECPSGPCQTPPQSDCCTCVPVR
CYFHGRWYADGAVFSGGGDECTTCVCQNGEVECSFMPCPELACPREEWRLGPGQCCFTCQ
EPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSVSCKRTDCVDSCPHPIRIPGQ
CCPDCSAGCTYTGRIFYNNETFPSVLDPCLSCICLLGSVACSPVDCPITCTYPFHPDGEC
CPVCRDCNYEGRKVANGQVFTLDDEPCTWCMCQLGEVSCEKVPCQRACADPALLPGDCCS
SCPDSLSPLEEKQGLSPHGNVTFSKAARSLHGDTEAPVNCSSCPGPPTASPSRPVLHLLQ
LLLRTNLMKTQTLPTSPAGAHGPHSPALGPTGTFPGEPGASPRLSPGPSTPPGAPTLPLA
SPGAPQPPPVTPERSFSASGAQIASRWPPLPATLLTEASALSMMDPSPSKTPITLLGPRM
LSPTTSRLSTALAATTHPGPQQPPVGASRGEESTM
Download sequence
Identical sequences ENSGGOP00000003974 ENSGGOP00000003974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]