SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004672 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004672
Domain Number 1 Region: 39-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.93e-34
Family SCAN domain 0.000084
Further Details:      
 
Domain Number 2 Region: 721-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 777-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 818-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-16
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 162-221
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000798
Family KRAB domain (Kruppel-associated box) 0.014
Further Details:      
 
Domain Number 6 Region: 674-710
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000177
Family Papain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004672   Gene: ENSGGOG00000004769   Transcript: ENSGGOT00000004792
Sequence length 904
Comment pep:known_by_projection chromosome:gorGor3.1:16:25951431:25968965:-1 gene:ENSGGOG00000004769 transcript:ENSGGOT00000004792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALDSQIDAPLEVEGCLIMKVEKDPEWASEPILEGSDSSETFRKCFRQFCYEDVTGPH
EAFSKLWELCCRWLKPELRSKEQILELLVIEQFLTILPEKIQAWAQKQCPQSGEEAVALV
LHLEKKTGRLRQQRPSAWVPALADEWNTLDQEVTTTRLPAGSQEPVKDVHVARGFSYRKN
VHQIPAQRDLYRDFRKENVGNVVSLGSAVSTSNKITRLEQRKEPWTLGLHSSNKRSILRS
NYVKEKSVHAIQVPARSAGKTWREQQQWGLEDEKIAGVHWSYEETKTFLAILKESRFYET
LQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHMLEPCAFFEDMD
ALLNPAARAPSTDKPKEMIPVPRLKRIAISAKEHISLVEEEEAAEDSDGDEIGIEFIRKS
EIHGAPVLFQNLSGVHWGYEETKTFLDILRETRFYEALQACHRKSKLYGAVAEQLRECGF
LRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINSQASAPSPSTPEEVPSPSR
QERGGIEVEPQELTGWEPEETSQEAVIEDSCSERMSEEEIVQEPEFQGPPGLLQSPNDFE
IGSSIKEDPTQIVYKDMEQHRALIEKSKRVVSQSTDPSKYRKRECISGRQWENLQGIRQG
KPMSQPRDLGKAVVHQRPFVGKRPYRLLKYGESFGRSTRLMCRMTHHKENPYKCGVCGKC
FGRSRSLIRHQRIHTGEKPFKCLDCGKSFNDSSNFGAHQRIHTGEKPYRCGECGKCFSQS
SSLIIHQRTHTGEKPYQCGECGKSFTNSSHFSTHRRVHTGENPYKCVDCEKSFSNCTRFR
EHRRIHTGEKPYGCAQCGKRFSKSSVLTKHREVHVREKPLPHPPSLYCPENPHKGKTDEF
RKTF
Download sequence
Identical sequences ENSGGOP00000004672 ENSGGOP00000004672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]