SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005672 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005672
Domain Number 1 Region: 24-149
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-19
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 2 Region: 141-239
Classification Level Classification E-value
Superfamily Immunoglobulin 5.02e-18
Family I set domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005672   Gene: ENSGGOG00000005793   Transcript: ENSGGOT00000005821
Sequence length 327
Comment pep:known_by_projection chromosome:gorGor3.1:11:122916235:122920979:-1 gene:ENSGGOG00000005793 transcript:ENSGGOT00000005821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWS
FVQPGKPISESHPILYFTSGHLYPTGSKSKRVSLLQNPPTGGVATLKLTDVHPSDTGTYL
CQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWV
RLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQG
RVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGGSDLREDAIAPGISEHTCMRA
DSSKGFLERPSSASTVTTTKSKLPMVV
Download sequence
Identical sequences G3QSN0
ENSGGOP00000005672 ENSGGOP00000005672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]