SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005813 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005813
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-23
Family V set domains (antibody variable domain-like) 0.00066
Further Details:      
 
Domain Number 2 Region: 284-363
Classification Level Classification E-value
Superfamily Immunoglobulin 2.19e-16
Family I set domains 0.0011
Further Details:      
 
Domain Number 3 Region: 104-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000107
Family I set domains 0.0061
Further Details:      
 
Domain Number 4 Region: 194-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000426
Family I set domains 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005813   Gene: ENSGGOG00000005936   Transcript: ENSGGOT00000005968
Sequence length 482
Comment pep:known_by_projection chromosome:gorGor3.1:19:39842312:39863719:-1 gene:ENSGGOG00000005936 transcript:ENSGGOT00000005968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFNVAEGKEVLLLVHNLPQPLFGYSWYKGERVDGNRQIVGYVIATQQATPGPAYSGRET
INPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDK
DAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNMTLTLLSVKRNDAGPYQCEIRDR
YGGIRSYPVTLNVLYGPDTPTISPSDTYYHPGANLSLSCYAASNPPAQYSWLINGTFQQS
TQELFIPNITVNNSGSYTCHANNSVTGRNRTTVKTIIVTELSPVVAKPQIKASKTTVTGD
KDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFN
PISKNQSDPIMLNNALPQENGLSPGAIAGIVIGVLALVVLIAVALACFLHFGKTGRASDQ
RDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSPTATEIIYSEV
KK
Download sequence
Identical sequences ENSGGOP00000005813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]