SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006291 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006291
Domain Number 1 Region: 269-360
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000123
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 449-527
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000143
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 180-270
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000207
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 3-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000011
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 355-441
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000472
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 103-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000249
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006291   Gene: ENSGGOG00000006433   Transcript: ENSGGOT00000006460
Sequence length 530
Comment pep:novel chromosome:gorGor3.1:19:40426410:40450435:-1 gene:ENSGGOG00000006433 transcript:ENSGGOT00000006460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWLLNGQSLPMTHRLQLSKTNRTLFI
FGVTKYTAGPYECEIRNSGSASHSDPVTLNLLHGLDAPTISSSYTYYHTGEFPNLSCLTD
SHPLAEHSWLIDGKFQQSAQVCFIPQITNTYRGVYVCFIHNSATDGTNLIIKRIIVPAKL
PKPYITINNLNPRENKDVLTFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPS
VTRNETGPYQCEIRDQYGGMRSDPVTLNVLYGPDVPRIYPSFTYYRSGENVYLSCLAESN
PPAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSMTVQVSVKLPK
PYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENTILILPSVT
RNETGPYQCEIRDMRSDPVSLNVLYGPDLPRIYPSFTYYRSGQNLYLSCFAESNPPAQYS
WTINGKFQLSGQKLSIPQVTTKHRGLYACSVRNSATGEESSKSMTVEVSG
Download sequence
Identical sequences ENSGGOP00000006291 ENSGGOP00000006291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]