SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006823 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006823
Domain Number 1 Region: 344-622
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-87
Family Eukaryotic proteases 0.000000000282
Further Details:      
 
Domain Number 2 Region: 103-193
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-31
Family Kringle modules 0.0000117
Further Details:      
 
Domain Number 3 Region: 213-301
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-27
Family Kringle modules 0.00000612
Further Details:      
 
Domain Number 4 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 5.72e-20
Family GLA-domain 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006823   Gene: ENSGGOG00000006967   Transcript: ENSGGOT00000007002
Sequence length 626
Comment pep:known_by_projection chromosome:gorGor3.1:11:47478193:47498604:1 gene:ENSGGOG00000006967 transcript:ENSGGOT00000007002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
MEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCAHPPGQDQVTVAMTPRSEGSSVNLSPPSEQCVPDRGQQYQGRLAVTTHGLPCLA
WASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVE
EETGDGLDEDPDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELL
ESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKN
FTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSD
YIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVC
KDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDR
DGKYGFYTHVFRLKKWIQKVIDQFGE
Download sequence
Identical sequences ENSGGOP00000006823 ENSGGOP00000006823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]