SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008073 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008073
Domain Number 1 Region: 133-225
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-17
Family I set domains 0.00057
Further Details:      
 
Domain Number 2 Region: 35-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000183
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008073   Gene: ENSGGOG00000008259   Transcript: ENSGGOT00000008298
Sequence length 312
Comment pep:known_by_projection chromosome:gorGor3.1:21:13934424:14008862:1 gene:ENSGGOG00000008259 transcript:ENSGGOT00000008298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSRHRLLLLLLCYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSR
LEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQN
LEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
LGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGI
IAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENVQWLTPVIPALW
KAVAGGSRGQEF
Download sequence
Identical sequences G3RN51
ENSGGOP00000017217 XP_004062670.1.27298 ENSGGOP00000008073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]