SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008647 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008647
Domain Number 1 Region: 95-179
Classification Level Classification E-value
Superfamily E set domains 0.000000000841
Family Filamin repeat (rod domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008647   Gene: ENSGGOG00000008842   Transcript: ENSGGOT00000008883
Sequence length 544
Comment pep:known_by_projection chromosome:gorGor3.1:11:112432468:112457622:-1 gene:ENSGGOG00000008842 transcript:ENSGGOT00000008883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISMINYKSLLALLFILASWIIFTVFQNSTKVWSALNLSISVHYRNNSAKSLFPKTPLI
PLKPLTETELRIKEIIEKLDQQIPPRPFTHVNTTTSAAHSTATILNPQDTYCRGDQLHIL
LEVRDHLGRRKQYGGDFLRARMSSPALMAGASGKVTDFNNGTYLVSFTLFWEGQVSLSLL
LIHPSEGASALWSARNQGYDRVIFTGQFVNGTSQVHSECGLILNTNAELCQYLDNRDQEG
FYCVRPQHMPCAALTHMYSKNKKVSYLSKQEKSLFERSNVGVEIMEKFNTVSVSKCNKET
VAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKECLRGKLIYLMGDSTIRQWMEY
FKASINTLKSVDLHESGKLQHQLAVDLDRNINIQWQKHCYPLIGSMTYSVKEMEYLTRAI
DRTGGEKNTVIVISLGQHFRPFPIDVFIRRVLNVHKAIQHLLLRSPDTMVIIKTENIREM
YNDAERFSDFHGYIQYLIIKDIFQDLSVSIIDAWDITIAYGTNNVHPPQHVVGNQINILL
NYIC
Download sequence
Identical sequences G3R0G2
ENSGGOP00000008647 ENSGGOP00000008647 XP_004052215.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]