SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008861 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008861
Domain Number 1 Region: 12-456
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-126
Family ALDH-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008861   Gene: ENSGGOG00000009060   Transcript: ENSGGOT00000009102
Sequence length 473
Comment pep:known_by_projection chromosome:gorGor3.1:14:55311114:55335092:-1 gene:ENSGGOG00000009060 transcript:ENSGGOT00000009102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVAAAAVRARILQPTVKLFIGGKFVESKSDKWIDIHNPATNEVIGRVPQATKAEMDA
AIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRG
LQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMV
CGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEGAKNHGVVMPDANKENTL
NQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVERAKNLRVNAGDQPGADLGPLITPQ
AKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPV
LVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMF
SFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Download sequence
Identical sequences ENSGGOP00000008861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]