SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009225 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009225
Domain Number 1 Region: 89-182
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000303
Family V set domains (antibody variable domain-like) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009225   Gene: ENSGGOG00000009444   Transcript: ENSGGOT00000009483
Sequence length 380
Comment pep:known_by_projection chromosome:gorGor3.1:6:42385008:42396102:-1 gene:ENSGGOG00000009444 transcript:ENSGGOT00000009483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPCGWLGAVGPTLPHFPKWAASLLEPQVLPWQAQVAHPVSGGPSPWISRPDTAQLDGTM
APAFLLLLLLWPQGCVSGPSADSVYTKVRLLEGGTLSVQCSYKGYKNRVEGKVWCKIRKK
KCEPGFARVWVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMGFQL
DVSPAPQTERNIPFTHLANILKSGTVTTGQAPTSGPDAPFTTGVMVFTPGLITLPRLLAS
TRPASKTGYSFTATSTTSQGPRRTTGSQTVTASPSNARDSSAGPESISTKSGDLSTRSPT
TGLCLTSRSLLNRLPSMPSIRHQDVYSTVLGVVLTLLVLMPIVVYGFWKKRHMASYSMCS
NPSRRDPPGRPEPYVEVYLI
Download sequence
Identical sequences XP_004044033.1.27298 ENSGGOP00000009225 ENSGGOP00000009225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]