SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009629 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009629
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.26e-21
Family V set domains (antibody variable domain-like) 0.00034
Further Details:      
 
Domain Number 2 Region: 247-358
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-20
Family V set domains (antibody variable domain-like) 0.00031
Further Details:      
 
Domain Number 3 Region: 116-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000043
Family C1 set domains (antibody constant domain-like) 0.026
Further Details:      
 
Domain Number 4 Region: 375-450
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000194
Family C2 set domains 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009629   Gene: ENSGGOG00000009855   Transcript: ENSGGOT00000009896
Sequence length 481
Comment pep:known_by_projection chromosome:gorGor3.1:6:33282074:33295503:-1 gene:ENSGGOG00000009855 transcript:ENSGGOT00000009896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILARVGEDALLTCQLLPKRTTMH
MEVRWYCSEPSTPVFVHRDGVEVTEMQIEEYRGRVEWIENGIAKGNVALKIHNIQPSDNG
QYWCHFQDGNYCGETSLLLKVAGLGSAPNIHMEGPGESGVQLECTTRGWFPEPQVYWEDI
QGEKLLAMSEHHIQDEDGLFYVEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQ
TELASLKVIGPSQPILVRVGEDIQLTCYLSPKANAQSMEARWVRSHRYPAVHVYMDGDHV
AGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVG
LGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGNTIPSSSQALTQGSHGLFRVQ
TLLRVTNISAVDVTCSISIPFLGEEKIATFSLSKSRMTFLWKTLLVWGLLLAVAVGLLRK
R
Download sequence
Identical sequences ENSGGOP00000009629 ENSGGOP00000009629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]