SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011706 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011706
Domain Number 1 Region: 721-785
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000816
Family VWC domain 0.0062
Further Details:      
 
Domain Number 2 Region: 308-366
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000241
Family VWC domain 0.011
Further Details:      
 
Domain Number 3 Region: 586-643
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000638
Family VWC domain 0.015
Further Details:      
 
Domain Number 4 Region: 227-300
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family VWC domain 0.0033
Further Details:      
 
Domain Number 5 Region: 513-573
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000711
Family VWC domain 0.0062
Further Details:      
 
Domain Number 6 Region: 660-716
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000178
Family VWC domain 0.0073
Further Details:      
 
Domain Number 7 Region: 473-501
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000258
Family Huristasin-like 0.0079
Further Details:      
 
Domain Number 8 Region: 442-475
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000523
Family Huristasin-like 0.003
Further Details:      
 
Domain Number 9 Region: 416-443
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000558
Family Huristasin-like 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011706
Domain Number - Region: 380-407
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00314
Family Huristasin-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011706   Gene: ENSGGOG00000011996   Transcript: ENSGGOT00000012045
Sequence length 944
Comment pep:known_by_projection chromosome:gorGor3.1:2a:37080806:37237755:1 gene:ENSGGOG00000011996 transcript:ENSGGOT00000012045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLNETANTHYLVVNCFTDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFE
FPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLPSRCVCN
PAGCLRKVCQPGNLNILVSKASGKPGECCDLYECKPVFGVDCRTVECPPVQQTACPPDSY
ETQVRLTADGCCTLPTRCECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTK
PACVFNNVEYYDGDMFRMDNCRFCRCQGGVAICFTAQCGEINCERYYVPEGECCPVCEDP
VYPFNNPAGCYANGLILAHGDRWREDDCTFCQCVNGERHCVATVCGQTCTNPVKVPGECC
PVCEEPTIITVDPPACGELSNCTLTGKDCINGFKRDHNGCRTCQCINTEELCSERKQGCT
LNCPFGFLTDAQNCEICECRPRPKKCRPIICDKYCPLGLLKNKHGCDICRCKKCPELSCS
KICPLGFQQDSHGCLICKCREVSASAGPPILLGTCLTVDGHHHKNEESWHDGCRECYCLN
GREMCALITCPVPACGNPTIHPGQCCPSCADDFVVQKPELSTPSICHAPGGEYFVEGETW
NIDSCTQCTCHSGRVLCETEVCPPLLCQNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYC
KNDEGDIFLAAESWKPDVCTSCICIDSVISCFSESCPSVSCERPVLRKGQCCPYCIVEDT
IPKKVVCHFSGKAYADEERWDLDSCTHCYCLQGQTLCSTVSCPPLPCVEPINVEGSCCPM
CPEMYVPEPTNIPIEKTNHRGEVDLEVPLWPTPSENDIVHLPRDMGHLQVDYRDNKLHPS
EDSSVDSIASVVVPIIICLSIIIAFLFINQKKQWIPLLCWYRTPTKPSSLNNQLVSVDCK
KGTRVQVDSSQRMLRIAEPDARFSGFYSMQKQNHLQADNFYQTV
Download sequence
Identical sequences ENSGGOP00000011706 ENSGGOP00000011706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]