SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012938 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012938
Domain Number 1 Region: 20-216
Classification Level Classification E-value
Superfamily Ribosomal protein L1 1.83e-54
Family Ribosomal protein L1 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012938   Gene: ENSGGOG00000013265   Transcript: ENSGGOT00000013311
Sequence length 216
Comment pep:novel chromosome:gorGor3.1:8:34452240:34452890:-1 gene:ENSGGOG00000013265 transcript:ENSGGOT00000013311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKVSRYTPQEAVREVLHRNHHKRHKFLDTVELQISLKNYDPQKDKRFSGTVRLKSTPH
PKFSVCVLGKQQHCDEAKAMDIPHMDIEALKKLNRNKKLAKKLAKKYDAILASESLIKQI
PVLGPGLNKARKFPSLLTPKENMVAKVDKVKFTIKFQIKKVLPLAVAVGHVKMTDYELVY
NIHLAVKFLVSLLKKNRQNVRALCIKRTMHKLQRLY
Download sequence
Identical sequences ENSGGOP00000012938 ENSGGOP00000012938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]