SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012993 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012993
Domain Number 1 Region: 87-224
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-37
Family FKBP immunophilin/proline isomerase 0.000000856
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012993
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00504
Family Mevalonate 5-diphosphate decarboxylase 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012993   Gene: ENSGGOG00000013322   Transcript: ENSGGOT00000013368
Sequence length 225
Comment pep:known_by_projection chromosome:gorGor3.1:14:26396251:26415203:-1 gene:ENSGGOG00000013322 transcript:ENSGGOT00000013368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHL
VTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKG
DKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEAL
LTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Download sequence
Identical sequences ENSGGOP00000012993 ENSGGOP00000012993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]