SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013459 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013459
Domain Number 1 Region: 325-420
Classification Level Classification E-value
Superfamily Immunoglobulin 3.58e-27
Family I set domains 0.00031
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-25
Family I set domains 0.00044
Further Details:      
 
Domain Number 3 Region: 25-120
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-23
Family I set domains 0.0000042
Further Details:      
 
Domain Number 4 Region: 149-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000036
Family I set domains 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013459   Gene: ENSGGOG00000013781   Transcript: ENSGGOT00000013847
Sequence length 488
Comment pep:known_by_projection chromosome:gorGor3.1:19:52082897:52089533:1 gene:ENSGGOG00000013781 transcript:ENSGGOT00000013847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEFRL
YREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSHTAGRSEPSDPLELVTTG
AWNRFSLALEGTNPANILILXXXXGSQVAFDSFILCKEGEDEHPQCVNSQSHTLGWSWAI
FSVSPVNPSRRWSYRCYAYDSSSPYVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEES
LTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAH
NLSSEWSAPSDPLDILITGQIHAIPSLSVQPGPTVVSGENVTLLCQSQGGMHTFLLTKEG
AADVPLRLRSKYQSHKYQAEFPVGPVTSAHAGTYRCYGSLNSNPYLLTHPSEPLELVVSG
AAETLSPPQNKSDSKAGAVNTLSPSQNKTASHPQDYTVENLIRMGIAGLILVVLGILLFE
AQHSQRSL
Download sequence
Identical sequences ENSGGOP00000013459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]