SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014207 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014207
Domain Number 1 Region: 548-1105
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2e-178
Family Myeloperoxidase-like 0.00000000324
Further Details:      
 
Domain Number 2 Region: 58-148
Classification Level Classification E-value
Superfamily Immunoglobulin 5.34e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 337-424
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 154-247
Classification Level Classification E-value
Superfamily Immunoglobulin 3.2e-22
Family I set domains 0.0081
Further Details:      
 
Domain Number 5 Region: 237-331
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-21
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014207
Domain Number - Region: 2-63
Classification Level Classification E-value
Superfamily L domain-like 0.00357
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014207   Gene: ENSGGOG00000014572   Transcript: ENSGGOT00000014617
Sequence length 1124
Comment pep:known_by_projection chromosome:gorGor3.1:8:49106714:49268406:-1 gene:ENSGGOG00000014572 transcript:ENSGGOT00000014617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLDSNALVCDCDLMWLGELLQGFAQHGHTQAAATCEYPMRLHGRAVASVTAEEFNCQSPR
ITFEPQDVEVPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDNTRLNVFDDGTLMIRNT
RESDQGVYQCMARNSAGEAKTQSAMLRYSSLPAKPSFVIQPQDTEVLIGTSTTLECMATG
HPQPHITWTRDNGLELDGSRHVATSSGLYLQNITQWDHGRFTCHANNSHGTVEAAANIIV
QVPPQFTVTPKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRI
DRAAQHDQGQYECQAVSSLGVKKVSVQLTVKPKVLAVFTQLPQDTSVEVGKNINISCHAQ
GEPQPIITWNKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRYECVARNSFGLAVTNMFL
TVTVLKDIKQAGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPL
IVEMARSGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDLVSPRSLSLIANLSGCTARRP
LPNCSDRCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYQDGICAPRXTVWARAAA
VTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTKDPPCFPMNTRHADP
RGTHAPCKLFARSSPACASGRPSATVDSVYAREQINQQTAYIDGSNVYGSSERESQALRD
PSVPRGLLRTGFPWPPSGKPLLPFSTGPPTECARQEQDSPCFLAGDHRANEHLALTAMHT
LWFREHNRVATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRG
YRGYNPNVNAGIINSFATAAFRFGHTLINPIFYRLNATLGEISEGHLPFHKALFSPSRII
KEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSATYSAAVDSAATIIQRGRDHGIPP
YADFRVFCNLTSVKNYEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVG
PTLMCLFVTQFQRLRDGDRFWYENPGVFTPAQLTQLKQASLGRVLCDNGDSIQQVQADVF
VKAEYPQDYLSCSEIPKVDLRVWQDCCADKQAGGTPEAGRVYRC
Download sequence
Identical sequences ENSGGOP00000014207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]