SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016280 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016280
Domain Number 1 Region: 91-174
Classification Level Classification E-value
Superfamily E set domains 3.36e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016280
Domain Number - Region: 181-232
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00125
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016280   Gene: ENSGGOG00000000033   Transcript: ENSGGOT00000016741
Sequence length 418
Comment pep:known_by_projection chromosome:gorGor3.1:5:142784619:142920014:-1 gene:ENSGGOG00000000033 transcript:ENSGGOT00000016741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRNANHDDLFLHRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNM
FVHNNSKHGRRARRLDPSEGTPSYLEHAATPCIKAISPSEGWTTGGATVIIIGDNFFDGL
QVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPT
IDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEAL
YSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYV
PSTTPQQTNYNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLP
SNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQGIKGYPPF
Download sequence
Identical sequences ENSGGOP00000016280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]