SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016380 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016380
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000154
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016380   Gene: ENSGGOG00000016788   Transcript: ENSGGOT00000016844
Sequence length 355
Comment pep:known_by_projection chromosome:gorGor3.1:11:57869712:57878270:-1 gene:ENSGGOG00000016788 transcript:ENSGGOT00000016844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAEQNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPAR
PVPQRTPPVVEEQPQPPSAMPPYPLSYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQPGPRGAAGYSWSPQRSTPPRPGYPRTPTGASGPGYPLGGGRVPSPGYPQQS
PYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGPAWPGY
Download sequence
Identical sequences G3RKU8
ENSGGOP00000016380 XP_018893156.1.27298 XP_018893157.1.27298 ENSGGOP00000016380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]