SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016397 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016397
Domain Number 1 Region: 653-859
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-33
Family Fibronectin type III 0.00092
Further Details:      
 
Domain Number 2 Region: 861-1045
Classification Level Classification E-value
Superfamily Fibronectin type III 2.95e-28
Family Fibronectin type III 0.00031
Further Details:      
 
Domain Number 3 Region: 367-460
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-22
Family I set domains 0.00039
Further Details:      
 
Domain Number 4 Region: 463-558
Classification Level Classification E-value
Superfamily Immunoglobulin 2.88e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 282-377
Classification Level Classification E-value
Superfamily Immunoglobulin 3.75e-20
Family I set domains 0.0021
Further Details:      
 
Domain Number 6 Region: 82-177
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-17
Family I set domains 0.00078
Further Details:      
 
Domain Number 7 Region: 186-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000412
Family I set domains 0.00046
Further Details:      
 
Domain Number 8 Region: 555-659
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000467
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016397   Gene: ENSGGOG00000016800   Transcript: ENSGGOT00000016861
Sequence length 1084
Comment pep:known_by_projection chromosome:gorGor3.1:11:97257173:97825533:1 gene:ENSGGOG00000016800 transcript:ENSGGOT00000016861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEYSKALPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWRGAAQNY
YSPINLYHSSDAFKQDEGVDYGPVFVQEPDDIIFPTDSDEKKVALNCEVRGNPVPSYRWL
RNGTEIDLESDYRYSLIDGTFIISNPSEAKDSGHYQCLATNTLGSILSREATLQFAYLGN
FSGRTRSAVSVREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQETGNLYI
SKVQTSDVGSYICLVKNTVTNARVLSPPTPLTLRNDGVMGEYEPKIEVHFPFTVTAAKGT
TVKMECFALGNPVPTITWMKVNGYIPSKARLRKSQAVLEIPNVQLDDAGIYECRAENSRG
KNSFRGQLQVYTYPHWVEKLNDTQLDSGSPLRWECKATGKPRPTYRWLKNGVPLSPQSRV
EMVNGVLMIHNVNQSDAGMYQCLAENKYGAIYASAELKILASAPTFALNQLKKTIIVTKD
REVVIECKPQGSPKPTISWKKGDRAVRENKRIAILPDGSLRILNASKSDEGKYVCRGENV
FGSAEIIASLSVKEPTRIELTPKRTELTVGESIVLNCKAIHDASLDVTFYWTLKGQPIDF
EEEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEAELLVRGPPGPPGI
VIVEEITESTATLSWSPAADNHSPISSYNLQARSPFSLGWQTVKTVPEIITGDMESAMAV
DLNPWVEYEFRVVATNPIGTGDPSTPSRMIRTNEAVPKTAPTNVSGRSGRRHELVIAWEP
VSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDESVPPLTPFEVKVGVYNN
KGDGPFSQIVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKD
MEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEVSATTKKPPPSQ
APSNLRWEQQGSQVSLGWEPVIPLANESEVVGYKVFYRQEGHSNSQVIETQKLQAVVPLP
DAGVYIIEVRAYSEGGDGTASSQIRVPSYSGGKITSAQSTLHTLSTSSSSVTLLLALMIP
STSW
Download sequence
Identical sequences ENSGGOP00000016397 ENSGGOP00000016397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]