SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017145 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017145
Domain Number 1 Region: 20-120
Classification Level Classification E-value
Superfamily Immunoglobulin 6.83e-51
Family V set domains (antibody variable domain-like) 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017145   Gene: ENSGGOG00000028232   Transcript: ENSGGOT00000029642
Sequence length 122
Comment pep:known_by_projection chromosome:gorGor3.1:14:88470522:88470988:-1 gene:ENSGGOG00000028232 transcript:ENSGGOT00000029642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSSYGMHWVRQAP
GKGLEWVAVISYDASNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDTV
RG
Download sequence
Identical sequences ENSGGOP00000017145 ENSGGOP00000017145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]