SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018425 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018425
Domain Number 1 Region: 231-318
Classification Level Classification E-value
Superfamily Immunoglobulin 4.95e-18
Family C1 set domains (antibody constant domain-like) 0.026
Further Details:      
 
Domain Number 2 Region: 17-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000209
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 3 Region: 127-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000284
Family C1 set domains (antibody constant domain-like) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018425   Gene: ENSGGOG00000027980   Transcript: ENSGGOT00000031562
Sequence length 484
Comment pep:novel chromosome:gorGor3.1:22:14644698:14646294:1 gene:ENSGGOG00000027980 transcript:ENSGGOT00000031562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALCSFPGVAGEDELQAIQPEKSVSVAAGESATLHCAMTSLIPVGPIMWFRGAGPGREL
IYNQKEGHFPRVTTVSDLTKRTNMDFSIRISNITPADAGTYYCVKFQKGSPDVELKSGAG
TELSVRAKPSAPVVSGPAARATPEHTVSFTCESHGFSPRDITLKWFKNGNQLSDFQTNVD
PAGESVSYSIHSTANAVLTRRDVHSQVICEVAHVTLQGDTLRGTANLSETIQVPPTLEVT
QQPMRAENQVNITCQVTKFYPRLQLTWLENGNVSRTETASTLTENKDGTYNWMSWLLVNV
SAHRDDVKLTCQVEHDGQSAVSKSHDLKVSAHPKEQGSNTAAENTGPNEQNIYIVVGVVC
TLLVALLMAALYLVRIGQKKAQGSTSSTRLHEPEKNARKITRDTNDITYADLNLPKGKKP
APRAAEPNSHTEYASIQTSLQPASEDTLTYADLDMVHLNRTPKQLAPKPELSFSEYASIQ
VLRK
Download sequence
Identical sequences ENSGGOP00000018425 ENSGGOP00000018425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]