SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018800 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018800
Domain Number 1 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-20
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 4 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 246-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 440-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018800   Gene: ENSGGOG00000027320   Transcript: ENSGGOT00000028408
Sequence length 544
Comment pep:known_by_projection chromosome:gorGor3.1:19:56052941:56059813:1 gene:ENSGGOG00000027320 transcript:ENSGGOT00000028408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFEDVAVYFSQEEWGLLDTAQRALYRRVMLDNFALVASLGLSTSRPRVVIQLERGEEPW
VPSGTDTTLSRTTYRRRNPGSWSLTEDRDVSGEWPRAFPDTPPGMTTSVFPVAGAYHSVK
SLQRQRGASPSRERKPTGVSVIYWERLLLGSGSGQASVSLRLTSPLRPPEGGRLREKTLT
EHALLGRQPRTPERQKPCAQEVPGRTFGSAQDLEAASGRGHHRVGAVWQEPSTWEELGEA
LPAGEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECAQCGKAFSQTSHLTQHQRIHSG
ETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCSECGKAFSHGSNLSQHRKIHAGGRPY
ACAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFKHQRVHTGEKPFACPQ
CGRAFSHSSNLTQHQLLHTGERPFRCVDCGKAFAKGAVLLSHRRIHTGEKPFVCTQCGRA
FRERPALFHHQRIHTGEKTVRRSRASLHPQARSVSGASSEGAPAKETEPTPASGPAAVSQ
PAEV
Download sequence
Identical sequences A0A2I2Y9J6
XP_018871908.1.27298 ENSGGOP00000018800 ENSGGOP00000018800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]