SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019011 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019011
Domain Number 1 Region: 4-212
Classification Level Classification E-value
Superfamily L domain-like 6.05e-32
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 2 Region: 208-309
Classification Level Classification E-value
Superfamily Immunoglobulin 7.4e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 443-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000492
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019011   Gene: ENSGGOG00000001382   Transcript: ENSGGOT00000029380
Sequence length 634
Comment pep:known_by_projection chromosome:gorGor3.1:4:119242096:119263087:1 gene:ENSGGOG00000001382 transcript:ENSGGOT00000029380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMNELPTNLPVDTVKLRIEKTVIRRISAEAFYYLVELQYLWVTYNSVASIDPSSFYNLK
QLHELRLDGNSLAAFPWASLLDMPLLRTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRL
TTLPPDFPESWSHLVTTPSGVLDLSPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVL
LDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQL
TWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTV
LGITTTPIPPDTSERTEDHPEWDVQLGSGRSTSVSSASSYLWSSSFSPTSSFSASTLSPP
STASFSLSPFSSSTVSSTTTLSTSISASTTMANKRSFQLHPGGKRNLKVAKNGSKLPPAS
TSKKEELALLDQTMLTETNATIENLRVVSETKESVTLMWNMINTTHNSAVTVLYSKYGGK
DLLLLNADSSKNQVTIDGLEPGGQYMACVCPKGVPPQKDQCITFSTERVEGDDSQWSLLL
VVTSTACVVILPLICFLLYKVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTR
RHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC
Download sequence
Identical sequences ENSGGOP00000019011 ENSGGOP00000019011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]