SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019102 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019102
Domain Number 1 Region: 101-502
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.46e-52
Family Glycerol-3-phosphate transporter 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019102
Domain Number - Region: 40-73
Classification Level Classification E-value
Superfamily Kringle-like 0.0754
Family Kringle modules 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019102   Gene: ENSGGOG00000003920   Transcript: ENSGGOT00000028463
Sequence length 542
Comment pep:known_by_projection chromosome:gorGor3.1:11:59784348:59807358:-1 gene:ENSGGOG00000003920 transcript:ENSGGOT00000028463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSEILDRVGSMGRFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPPNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRATEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAAFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
Download sequence
Identical sequences G3RTH7
ENSGGOP00000019102 XP_004051438.1.27298 XP_004051439.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]