SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019628 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019628
Domain Number 1 Region: 25-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.27e-21
Family V set domains (antibody variable domain-like) 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019628   Gene: ENSGGOG00000024695   Transcript: ENSGGOT00000028282
Sequence length 152
Comment pep:novel chromosome:gorGor3.1:21:1911878:1926471:1 gene:ENSGGOG00000024695 transcript:ENSGGOT00000028282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAATMALLLRFVLLCGVADFIRGWSITTPEQMIEKAKGETAYLPCKFTLSPEDQGPLDIE
WLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFKSNDLKSGDASINVTNFQLSDIG
TDQCKVKRAPGVANRKIQLVVLGKPSGTRCYV
Download sequence
Identical sequences ENSGGOP00000019628 ENSGGOP00000019628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]