SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020851 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020851
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-30
Family PDZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 4.71e-26
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020851   Gene: ENSGGOG00000026123   Transcript: ENSGGOT00000025971
Sequence length 197
Comment pep:known_by_projection chromosome:gorGor3.1:11:27879316:27891665:-1 gene:ENSGGOG00000026123 transcript:ENSGGOT00000025971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQT
Download sequence
Identical sequences A0A0D9QYU3 A0A1S3ALI2 A0A1S3FF08 A0A1U7Q352 A0A212DIE1 A0A250XW39 A0A287CSY9 A0A2I2V095 A0A2I3GMY7 A0A2I3MG07 A0A2J8S4J3 A0A2K5DRK3 A0A2K5IWN0 A0A2K5M7W7 A0A2K5ZWT6 A0A2K6BYC2 A0A2K6G7V4 A0A2K6K1N3 A0A2K6P3B6 A0A2K6UNG5 E2RJN7 F2Z5M5 F7AL97 F7DG56 F7DL15 F7FZJ5 G1M7J7 G3I6E3 G3RYG3 G3T4X6 G7PQI3 H0X910 H2R0V3 K9IWP6 M3YIF2 O88952 Q0P5F3 Q5RAA5 Q792I0 Q9NUP9 W5Q0E7
ENSCJAP00000018813 ENSLAFP00000008432 ENSPPYP00000003906 ENSMUSP00000028583 ENSMODP00000011812 ENSSTOP00000008009 ENSOARP00000016183 10090.ENSMUSP00000028583 10116.ENSRNOP00000007343 13616.ENSMODP00000011812 9258.ENSOANP00000015426 9544.ENSMMUP00000030433 9598.ENSPTRP00000041313 9600.ENSPPYP00000003906 9606.ENSP00000278193 9823.ENSSSCP00000014167 ENSOANP00000015426 ENSDORP00000002587 ENSLAFP00000008432 ENSP00000278193 ENSSTOP00000008009 ENSRNOP00000007343 ENSMUSP00000028583 ENSEEUP00000000110 ENSFCAP00000019364 ENSOANP00000015426 ENSGGOP00000020851 ENSNLEP00000021690 ENSP00000278193 ENSPVAP00000005062 ENSMICP00000004705 ENSMODP00000011812 NP_001068899.1.59421 NP_001068899.1.76553 NP_001125773.1.23681 NP_001253380.1.72884 NP_035829.1.92730 NP_060832.1.87134 NP_060832.1.92137 NP_068623.1.100692 NP_068623.1.4139 XP_001368355.1.35504 XP_001508719.1.37387 XP_002709070.1.1745 XP_002746724.1.60252 XP_002920476.1.58354 XP_003122952.1.46622 XP_003254391.1.23891 XP_003412358.1.64505 XP_003510746.1.69978 XP_003773697.1.9362 XP_003781245.1.62490 XP_003830483.1.60992 XP_003919986.1.74449 XP_003993166.1.62641 XP_004016405.1.66739 XP_004050894.1.27298 XP_004263986.1.21590 XP_004318954.2.83887 XP_004408714.1.74151 XP_004418596.1.5094 XP_004454326.1.11602 XP_004585501.1.84141 XP_004607916.1.94378 XP_004644174.1.9945 XP_004660908.1.11716 XP_004683025.1.23501 XP_004708309.1.18182 XP_004755947.1.14098 XP_005064866.1.91757 XP_005328111.1.77405 XP_005364110.1.66349 XP_005401807.1.28644 XP_005578410.1.63531 XP_005890728.1.15283 XP_005967881.1.78601 XP_006045479.1.26621 XP_006198418.1.17985 XP_006727345.1.47382 XP_006864912.1.41390 XP_006902215.1.29581 XP_006908049.1.64745 XP_006980879.1.50099 XP_007098525.1.5354 XP_007462662.1.90284 XP_007537025.1.11023 XP_007625955.1.28591 XP_007950148.1.48129 XP_008001922.1.81039 XP_008147174.1.99482 XP_008582453.1.73410 XP_008685104.1.72690 XP_010372830.1.97406 XP_010963049.1.22495 XP_010998556.1.51371 XP_011360872.1.92234 XP_011708614.1.29376 XP_011791696.1.43180 XP_011820103.1.47321 XP_011887096.1.92194 XP_011998830.1.54773 XP_012307660.1.9421 XP_012505113.1.63892 XP_012600109.1.48125 XP_012875071.1.60039 XP_012875072.1.60039 XP_012875073.1.60039 XP_014639156.1.5094 XP_015333213.1.40921 XP_016002902.1.101085 XP_016061639.1.3490 XP_017394213.1.71028 XP_017523100.1.32401 XP_017714293.1.44346 XP_017914793.1.57651 XP_019312121.1.44245 XP_019506254.1.44202 XP_019604732.1.88060 XP_020032905.1.5219 XP_020734321.1.74333 XP_020833631.1.61212 XP_021049082.1.100879 XP_021483197.1.76796 XP_021541007.1.83697 XP_521874.2.37143 XP_542543.2.84170 ENSNLEP00000021690 ENSPTRP00000041313 ENSRNOP00000065941 ENSCAFP00000014981 ENSSARP00000001741 ENSCHOP00000000094 ENSMPUP00000011109 ENSP00000278193 ENSPVAP00000005062 ENSPTRP00000041313 ENSEEUP00000000110 ENSSSCP00000027907 ENSOGAP00000012008 ENSGGOP00000020851 ENSAMEP00000015317 ENSSARP00000001741 ENSDNOP00000029970 ENSMMUP00000030433 ENSMPUP00000011109 ENSMMUP00000030433 ENSOGAP00000012008 ENSCJAP00000018813 ENSAMEP00000015317 ENSBTAP00000001914 ENSSSCP00000027907 ENSPANP00000008345 ENSBTAP00000001914 ENSDORP00000002587 ENSMICP00000004705 gi|8922944|ref|NP_060832.1| ENSCHOP00000000094 ENSPPYP00000003906 ENSMUSP00000028583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]