SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021327 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021327
Domain Number 1 Region: 34-513
Classification Level Classification E-value
Superfamily ALDH-like 4.45e-126
Family ALDH-like 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021327   Gene: ENSGGOG00000009060   Transcript: ENSGGOT00000026667
Sequence length 530
Comment pep:known_by_projection chromosome:gorGor3.1:14:55308182:55335092:-1 gene:ENSGGOG00000009060 transcript:ENSGGOT00000026667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVAAAAVRARILQVTSKVGSRQQWASIKSFDHKEPTVKLFIGGKFVESKSDKWIDIH
NPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIA
KLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCA
GIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHG
QHEVLNVFSLIMNLLRSFILSHVNIALHITEKPSRQQIPGAKNHGVVMPDANKENTLNQL
VGAAFGAAGQRCMALSTAVLVGEAKKWLPELVERAKNLRVNAGDQPGADLGPLITPQAKE
RVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPVLVV
LETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMFSFT
GSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Download sequence
Identical sequences ENSGGOP00000008861 ENSGGOP00000021327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]