SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021704 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021704
Domain Number 1 Region: 293-351
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000136
Family BSTI 0.098
Further Details:      
 
Domain Number 2 Region: 660-720
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000916
Family BSTI 0.025
Further Details:      
 
Domain Number 3 Region: 1960-2014
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000458
Family ATI-like 0.03
Further Details:      
 
Domain Number 4 Region: 759-822
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000213
Family ATI-like 0.014
Further Details:      
 
Domain Number 5 Region: 344-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000847
Family VWC domain 0.064
Further Details:      
 
Domain Number 6 Region: 2108-2184
Classification Level Classification E-value
Superfamily FnI-like domain 0.000022
Family VWC domain 0.034
Further Details:      
 
Domain Number 7 Region: 820-862
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000555
Family VWC domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021704
Domain Number - Region: 1131-1187
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00164
Family BSTI 0.04
Further Details:      
 
Domain Number - Region: 710-752
Classification Level Classification E-value
Superfamily FnI-like domain 0.00534
Family Fibronectin type I module 0.054
Further Details:      
 
Domain Number - Region: 1187-1224
Classification Level Classification E-value
Superfamily FnI-like domain 0.0377
Family VWC domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021704   Gene: ENSGGOG00000000201   Transcript: ENSGGOT00000028959
Sequence length 2367
Comment pep:novel chromosome:gorGor3.1:11:1035926:1067727:1 gene:ENSGGOG00000000201 transcript:ENSGGOT00000028959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGDFHYKTFDGDVFRFPGLCD
YNFASDCRGSYREFAVHLKRGPGQAEAPAGVESILLTIRDDTIYLTRHLAVLNGAMVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQNRCRCPGGDTCICSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLENGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA
SFSVFRPSSYHIMVSMAIGIRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACSAKGVMLWGWREHVCNKDVGS
CPDSQVFLYNLTTCQQTCRSLSEADSHCLQGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSRPR
ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
SVPTEEICKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSTTT
RPSTLTTFTTTPTTFTTTTTTTTPTPSTVLSTTPKLCCLWSDWINEDHPSSGSDGGDRET
FDGVCGAPEDIECRSVEDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGQFGLCYDYKIR
VNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPPPESSTPQTSRSTSSPVMESTTLLSTL
PPATETTSTAPPSTPTAPTTTRGAHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQT
TTTSAWTPTPTLLSTPSIITTTGLRPYHSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFV
NCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSPTPSKPTPSTKPPECPDFDPPRQE
NETWWLCDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYC
TGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIV
RHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYN
GLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHC
PHSSSTTKRPAVTVPGGGKTTPHNDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDS
CFMPGSSLECASLQAYAALCAQQNVCLDWRNHTHGACLVECPSHREYQACGPAEEPTCKS
SSSQQSNTVLVEGCFCPEGTMNYAPGYDVCVKTCFGEHFEFDCKNCVCLEGGSGIICQPK
RCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPPVCPLGFEVKSKMVPG
RCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACSHVPCNTS
CSPGFELMETPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQL
ISSVSNITCPNFDASICIPGSITLMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKT
VLMNRCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESC
QCQDTVCGLPTGTSRRARRSPRHLGSG
Download sequence
Identical sequences ENSGGOP00000021704 ENSGGOP00000000198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]