SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024100 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024100
Domain Number 1 Region: 2-541
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.92e-81
Family Acetyl-CoA synthetase-like 0.000019
Further Details:      
 
Domain Number 2 Region: 754-1052
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.03e-41
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 553-608
Classification Level Classification E-value
Superfamily ACP-like 0.0000563
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024100   Gene: ENSGGOG00000023372   Transcript: ENSGGOT00000031201
Sequence length 1054
Comment pep:known_by_projection chromosome:gorGor3.1:4:64583364:64631135:-1 gene:ENSGGOG00000023372 transcript:ENSGGOT00000031201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSDFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTYFMKKCDLKYILVEKKQINKFK
SFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSDHVNAEKA
EEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQL
IKSTVLSATTSLRVLALGGEAFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLPEDLLRVPDESLFLNSGGDSLKSIRLLSEIE
KLVGTSVPGLLEIILSSSILEIYNHILQTVVPDEDVTFRKSCTTKRKLSDINQEEASGTS
LHQKAIMTFSCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLK
GLNSPVLIGKSKDPSCVAKVSEEGKPAIGTQKMELHVRWRSDTGKCVDASPLVVIPTSDK
SSTTVYIGSHSHRMKAVDFYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVLK
SNSGEKYWMFTTEDAVKSSATMDPTTGLIYIGSHDQHAYALDIYRKKCVWKSKCGGTVFS
SPCLNLIPHHLYFATLGGLLLAVNPVWQFSTSGPIFSSPCTSPSEQKILFGSHDCFIYCC
NMKGHLQWKFETTSRVYATPFAFHNYNGSNEMLLAAASTDGKVWILESQSGQLQSVYELP
GEVFSSPVVLESMLIIGCRDNYVYCLDLFGGNQK
Download sequence
Identical sequences ENSGGOP00000024100 ENSGGOP00000024100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]