SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025773 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025773
Domain Number 1 Region: 67-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000212
Family I set domains 0.0072
Further Details:      
 
Domain Number 2 Region: 175-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000572
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 355-430
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000437
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025773   Gene: ENSGGOG00000016631   Transcript: ENSGGOT00000022234
Sequence length 591
Comment pep:known_by_projection chromosome:gorGor3.1:19:41715590:41737395:-1 gene:ENSGGOG00000016631 transcript:ENSGGOT00000022234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPADSWGHHWMGILLSASLCTVWSPPAAAQLTLNANPLDATQSEDVVLPVFGTPRTPQI
HGRSRELAKPSIAVSPGTAIEQKDMVTFYCTTKDVNITIHWVSNNLSVVFHERMQLSKDG
KILTILIVQREDSGTYQCEARDALLSQRSDPIFLDVKYGPDPVEIKLESGVASGEVVEVM
EGSSVTFLAETKSHPPSAYTWFLLDSILSHTTRTFTIHAVSREHEGLYRCLVSNSATHLS
SLGTLKVRVLGESPFPVPLLHSSERQMLAMSEGSLCSSLHFSVAHSSFLQPFASFPVFYI
NLSKTLLIYMRNPTTTFICFLLICGGRGRLKTSELLYKDGPDQVHITRESASEMISTIEA
ELNSSLTLQCWAESKPGAEYRWTLEHSTGEHLGEQLIIRALTWEHDGIYNCTASNSLTGL
ARSASVLVKVVGPQSSSLSSGAIAGIVIGILAVIAVASELGYFLYIRNARRPSRKTTEDP
SHETSQPIPKEEHPTEPSSESLSPEYCNISQLQGRIRVELMRPPDLPEETYETKLPSARR
GGNSFSPWKPPPKPLVPPLRLVSTVPKNMESIYEELVNPEPNTYIQINPSV
Download sequence
Identical sequences ENSGGOP00000025773 ENSGGOP00000016230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]