SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026373 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026373
Domain Number 1 Region: 34-147,197-247
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.89e-39
Family Matrix metalloproteases, catalytic domain 0.00014
Further Details:      
 
Domain Number 2 Region: 301-378
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000811
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026373   Gene: ENSGGOG00000000303   Transcript: ENSGGOT00000026123
Sequence length 382
Comment pep:known_by_projection chromosome:gorGor3.1:1:1598515:1600364:1 gene:ENSGGOG00000000303 transcript:ENSGGOT00000026123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLKGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPR
ETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGEL
AHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGDRPGSWRPLLCSTVGCRGRALGQTAGGTF
RGGGCYWSLAGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWG
LHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKT
RLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTY
TCVVRRQQRVLTTYSWRVRVRG
Download sequence
Identical sequences ENSGGOP00000026373 ENSGGOP00000026373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]