SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026941 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026941
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.49e-78
Family MHC antigen-recognition domain 0.00000000852
Further Details:      
 
Domain Number 2 Region: 180-271
Classification Level Classification E-value
Superfamily Immunoglobulin 9.77e-32
Family C1 set domains (antibody constant domain-like) 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026941   Gene: ENSGGOG00000005772   Transcript: ENSGGOT00000025131
Sequence length 310
Comment pep:known_by_projection chromosome:gorGor3.1:6:30740618:30744277:1 gene:ENSGGOG00000005772 transcript:ENSGGOT00000025131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEGET
RNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYL
ALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADP
PKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKW
AAVVVPSGEEQRYTCHVQHEGLPQPLTLRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVA
AVMWRKKISD
Download sequence
Identical sequences ENSGGOP00000026941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]