SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028393 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028393
Domain Number 1 Region: 36-505
Classification Level Classification E-value
Superfamily Sema domain 3.79e-148
Family Sema domain 0.00000000794
Further Details:      
 
Domain Number 2 Region: 508-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000353
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 573-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000251
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028393   Gene: ENSGGOG00000025153   Transcript: ENSGGOT00000024656
Sequence length 830
Comment pep:known_by_projection chromosome:gorGor3.1:10:114496229:114507723:1 gene:ENSGGOG00000025153 transcript:ENSGGOT00000024656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRLWPLLLSILTATAVPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLL
LEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNSTHLYACGTHAFQPLCAAIDAEAFTLPTSFEEGKEKCPYDPARGFTGLIIDGGL
YTATRYEFRSIPDIRRSRHPHSLRTEETPMHWLNDAEFVFSVLVRESKASAVGDDDKVYY
FFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGKKILQKKWTSFLKARLICHIPLYE
TLRGVCSLDAETSSRTHFYAAFTLSTQWKTLEASAICRYDLAEIQAVFAGPYMEYQDGSR
RWGRYEGGVPEPRPGSCITDSLRSQGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLL
LKRNIRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFREPQSV
ENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAATTI
ANRSQGSRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALW
LLNGSMGLSDGQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATP
APAPKAPATPGAQLAPDVRLLYVLAIAALGGLCLILASSLLYVACLQEGRRGRRRKYSLG
RASRAGGSAVQLQTVSGQCPGEEDEGDDEGAGGLEGSCLQIIPGEGAELTNGLVALPSRL
RRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLVEQLDESSV
Download sequence
Identical sequences ENSGGOP00000028393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]