SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|563654523|ref|YP_008862607.1| from Salmonella enterica subsp. enterica serovar Agona str. 24249

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563654523|ref|YP_008862607.1|
Domain Number 1 Region: 18-66
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 1.23e-18
Family Outer membrane lipoprotein 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|563654523|ref|YP_008862607.1|
Sequence length 77
Comment murein lipoprotein [Salmonella enterica subsp. enterica serovar Agona str. 24249]
Sequence
MGTIILATSLLSGCVNEERVNHLSSDIQTLNAKIDRLQRDINALRPEVYAAKAEASRANT
RLDAKDFFDCLRLYSDY
Download sequence
Identical sequences B5F656 G4C2E8 G5MNC0 S5HPH4 V7IPK2
454166.SeAg_B3344 gi|525860307|ref|YP_008262423.1| gi|197249416|ref|YP_002148090.1| CP001138|CDS_3246360-3246593 gi|563654523|ref|YP_008862607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]