SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|563654579|ref|YP_008862665.1| from Salmonella enterica subsp. enterica serovar Agona str. 24249

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563654579|ref|YP_008862665.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.46e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|563654579|ref|YP_008862665.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Salmonella enterica subsp. enterica serovar Agona str. 24249]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYASRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
ALTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences B5F6B5
gi|197247696|ref|YP_002148149.1| gi|563654579|ref|YP_008862665.1| CP001138|CDS_3309185-3311203 454166.SeAg_B3406 WP_000121522.1.10013 WP_000121522.1.100721 WP_000121522.1.100773 WP_000121522.1.100790 WP_000121522.1.100932 WP_000121522.1.10507 WP_000121522.1.10797 WP_000121522.1.11369 WP_000121522.1.11621 WP_000121522.1.12059 WP_000121522.1.12063 WP_000121522.1.12650 WP_000121522.1.13429 WP_000121522.1.13829 WP_000121522.1.14528 WP_000121522.1.15479 WP_000121522.1.1551 WP_000121522.1.15978 WP_000121522.1.16052 WP_000121522.1.16158 WP_000121522.1.16273 WP_000121522.1.16565 WP_000121522.1.16656 WP_000121522.1.16826 WP_000121522.1.17949 WP_000121522.1.18445 WP_000121522.1.18919 WP_000121522.1.19469 WP_000121522.1.20081 WP_000121522.1.20795 WP_000121522.1.22623 WP_000121522.1.23080 WP_000121522.1.23258 WP_000121522.1.23675 WP_000121522.1.24696 WP_000121522.1.24837 WP_000121522.1.25205 WP_000121522.1.25514 WP_000121522.1.25703 WP_000121522.1.26883 WP_000121522.1.272 WP_000121522.1.2723 WP_000121522.1.28002 WP_000121522.1.28267 WP_000121522.1.28776 WP_000121522.1.28811 WP_000121522.1.28977 WP_000121522.1.29732 WP_000121522.1.30331 WP_000121522.1.30696 WP_000121522.1.31155 WP_000121522.1.31214 WP_000121522.1.3278 WP_000121522.1.33659 WP_000121522.1.34084 WP_000121522.1.34881 WP_000121522.1.35835 WP_000121522.1.36229 WP_000121522.1.36885 WP_000121522.1.37021 WP_000121522.1.37147 WP_000121522.1.37158 WP_000121522.1.3728 WP_000121522.1.37610 WP_000121522.1.38055 WP_000121522.1.38113 WP_000121522.1.3828 WP_000121522.1.38995 WP_000121522.1.40259 WP_000121522.1.40910 WP_000121522.1.4109 WP_000121522.1.41265 WP_000121522.1.41308 WP_000121522.1.41593 WP_000121522.1.41628 WP_000121522.1.4184 WP_000121522.1.41862 WP_000121522.1.41931 WP_000121522.1.42453 WP_000121522.1.43272 WP_000121522.1.43676 WP_000121522.1.43828 WP_000121522.1.43864 WP_000121522.1.44359 WP_000121522.1.44453 WP_000121522.1.44636 WP_000121522.1.45134 WP_000121522.1.46358 WP_000121522.1.46637 WP_000121522.1.47460 WP_000121522.1.47482 WP_000121522.1.47614 WP_000121522.1.47767 WP_000121522.1.48751 WP_000121522.1.49005 WP_000121522.1.49214 WP_000121522.1.5114 WP_000121522.1.5125 WP_000121522.1.51704 WP_000121522.1.51910 WP_000121522.1.53315 WP_000121522.1.53814 WP_000121522.1.5392 WP_000121522.1.5415 WP_000121522.1.55166 WP_000121522.1.55803 WP_000121522.1.56004 WP_000121522.1.56468 WP_000121522.1.57076 WP_000121522.1.57344 WP_000121522.1.5753 WP_000121522.1.58131 WP_000121522.1.58239 WP_000121522.1.58416 WP_000121522.1.59006 WP_000121522.1.5929 WP_000121522.1.59979 WP_000121522.1.60503 WP_000121522.1.60622 WP_000121522.1.60760 WP_000121522.1.60863 WP_000121522.1.61732 WP_000121522.1.62144 WP_000121522.1.62693 WP_000121522.1.63690 WP_000121522.1.63860 WP_000121522.1.63866 WP_000121522.1.63912 WP_000121522.1.63958 WP_000121522.1.64034 WP_000121522.1.6451 WP_000121522.1.67776 WP_000121522.1.67814 WP_000121522.1.6785 WP_000121522.1.67969 WP_000121522.1.69554 WP_000121522.1.70003 WP_000121522.1.70169 WP_000121522.1.70327 WP_000121522.1.70733 WP_000121522.1.70761 WP_000121522.1.70899 WP_000121522.1.714 WP_000121522.1.72243 WP_000121522.1.72793 WP_000121522.1.74089 WP_000121522.1.74454 WP_000121522.1.75301 WP_000121522.1.75740 WP_000121522.1.7672 WP_000121522.1.76799 WP_000121522.1.7684 WP_000121522.1.77241 WP_000121522.1.7814 WP_000121522.1.78881 WP_000121522.1.79974 WP_000121522.1.80473 WP_000121522.1.81736 WP_000121522.1.83258 WP_000121522.1.84209 WP_000121522.1.85217 WP_000121522.1.85408 WP_000121522.1.85864 WP_000121522.1.86284 WP_000121522.1.86656 WP_000121522.1.8691 WP_000121522.1.87282 WP_000121522.1.88214 WP_000121522.1.88683 WP_000121522.1.88970 WP_000121522.1.91405 WP_000121522.1.91864 WP_000121522.1.92099 WP_000121522.1.92394 WP_000121522.1.92827 WP_000121522.1.92947 WP_000121522.1.94717 WP_000121522.1.95623 WP_000121522.1.95729 WP_000121522.1.96042 WP_000121522.1.96190 WP_000121522.1.96642 WP_000121522.1.9863 WP_000121522.1.99278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]