SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|167389|fgenesh2_pg.C_sca_66000033 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|167389|fgenesh2_pg.C_sca_66000033
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.57e-74
Family Calponin-homology domain, CH-domain 0.00003
Further Details:      
 
Domain Number 2 Region: 3105-3232
Classification Level Classification E-value
Superfamily Spectrin repeat 1.97e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 3 Region: 3963-4117
Classification Level Classification E-value
Superfamily Spectrin repeat 2.77e-21
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 4 Region: 2682-2804
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-20
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 5 Region: 4177-4301
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-20
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 6 Region: 3534-3666
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 5677-5801
Classification Level Classification E-value
Superfamily Spectrin repeat 6.53e-19
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 8 Region: 4823-4942
Classification Level Classification E-value
Superfamily Spectrin repeat 5.9e-18
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 9 Region: 2893-3012
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 3320-3443
Classification Level Classification E-value
Superfamily Spectrin repeat 7.64e-17
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 11 Region: 1604-1743
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-17
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 12 Region: 5036-5163
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-16
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 13 Region: 5252-5372
Classification Level Classification E-value
Superfamily Spectrin repeat 4.94e-16
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 1694-1851
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000173
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 3748-3871
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000576
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 5787-5906
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000763
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 17 Region: 4607-4734
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000786
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 18 Region: 1483-1605
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 19 Region: 740-899
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000188
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 20 Region: 4394-4518
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000257
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 21 Region: 5462-5586
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 22 Region: 2490-2588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000216
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 23 Region: 1062-1205
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000348
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 24 Region: 5377-5503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000432
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 25 Region: 1961-2073
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000204
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 26 Region: 3231-3329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000102
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 27 Region: 3879-3976
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000828
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 28 Region: 2804-2898
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000224
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 542-676
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000233
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 2411-2525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000288
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 31 Region: 2134-2265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000432
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 1217-1325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000118
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 33 Region: 1287-1424
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000123
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number 34 Region: 6033-6170
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000051
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 35 Region: 3661-3762
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000072
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 36 Region: 4948-5049
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000126
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 37 Region: 2599-2693
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000247
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 38 Region: 4736-4813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000403
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 39 Region: 914-1000
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000471
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 40 Region: 5593-5690
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000112
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 41 Region: 3449-3545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000139
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 42 Region: 357-479
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000188
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 43 Region: 1801-1956
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000719
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 44 Region: 5915-6019
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000755
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 45 Region: 4520-4618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000925
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|167389|fgenesh2_pg.C_sca_66000033
Domain Number - Region: 4306-4384
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000482
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 3023-3116
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 685-767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00317
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|167389|fgenesh2_pg.C_sca_66000033
Sequence length 6756
Sequence
MAGYLDSVGGNSKERAFTNRVNWLKDEQERVQKKTFTNWMNTYLCQHVPPEKVDDLFEDI
KSGVVLLSLLEVLSGETLKMERGKNIKRPHFLSNIKKALDFLEGKKIKMVNINTTDIADG
KPAIVLGLIWTIILYFQIEETMSQVPNVQDLTGEGPSASKKMALPKKNLLAWVDSVLGKK
YGIEVKDFGPSWRSGVAFNQLIHNINPNLIDMEGVKQQTARVNLERAFSIADSELGIPRL
LDAEDVDVAKPDEKSIMTYVAQFLKKYPDAGDSKLQGIPSKMDTPDQEMSAYFSLYNWLS
KDAAEILANTRGPVTDRHSEFLDYLGFKTELDRRETVYLALKDRAMTGKFKRVNPQEWQQ
LQDKWEETEELTRLWLLKLDQSYPGRLGEFGRWLYEAETLLKKPEESFDNPEDMASYIGE
LLAEHKRFFKDLEPQKKFFEQVKKAGHFEGEQLDPPHMDLMAKRLQRVCTLAPVRQRRLD
YEGAKMRVWSIMLMTEDKIKSWKVKYGWQEEVEEMYKDYENLVQGNQLIMTYDSTFAEVK
GKGDTYRKDAKVSPEVKNIPEEIESISTKWRVLSQEIQGLKPTFEKQIVMWKNYASDVNA
LTAWLDGGEKVMKENSAENRAYFFGDTSDIEKKFVTLNKSGEYLIGTSQQPIADEIRQTI
EDLNNHFNVLKQDFTVYQQNEVVDKARSEYTSGYSTVHEWLEYADSIVQSPVPCIHADLK
EYLLKLEELSTRVPDIENEFKVITKTAQSLVKNTPPEVINEMLQNLNIKKEIIVRIRKQI
PDKKKYLKAVLPNVESLETGLIDLNKWLDEGEDLIQSHKMEGNAADSETTLEQHKAFFSQ
LIYQKSILESKNKVYNKICSTKPKLNNVDFQPVDDVMNTVNTRFQNLQTSSKDWERKLES
QVKLWRLLGVKQTQLEEWLDNAEAILEENSDDVESLIRKHRRFFDRVDEKPLKEYLSAGK
QILQTLSQPDSQQLQLEMEQLEARYKNILHHAPLRLLHLEFSLPEGKFCQNMETAEKALK
QHQEQLQSRVNVKEALLKHKQIFQDGQLMPTMEKYLESMGEKGNMLMKLTKTDSTLVDRH
KDYVDQYNKLQSYVGNIHLQLKQLPERWKEYHNRLSEFSTWVQEVEGLITEMKKPNLSSE
EYREALAKFQKAMKNRAKYADEAKWLEDNLNELNQDSNTADARKEREKLQNLINRFDKLK
PAMDQTAGKSSIYTKSFDYRDNLSRQFGWLDDAHKHVMEQPCIDSLEQAKECLNEHEGIM
RRLEEEKARVMADLEAGRRLQQDKDAPDFVSKAVADLDKKWKDTNHLAKAKQEKLRAQVE
NWESYEGNRGLLMKYLKDAEAELEKPPASPGQDQAEKDFHNKKELQKSLNKLKGSLSEMQ
KLNSLLCEGASRERQGPLKAEVSDIDVKLDNIAKRLNAKLADLETTISKWAEYYKRLNHF
CDWLNERESNLNEVYENKGDSPEQKLEKAEEISTEVYENHISLETLEKDARGLTQNFRSR
ETSALKTKLTSVRRQWESLCSRAKDRSTTLSGNVAHWQKYQNLQSQLTPWIVKGEKYCAT
ELPKCTSLAEAQELYNLHQSFLQECENNLPIFDKMSTEAGYLLEQPNVARELDGIQKRWG
NILNTSDDRTHKLDKMYGAWTAYENEVADFREILQKFQNRLAVEPNMSSSDVHVLEHELA
LAKSLQEEIRGHQPRLNTLQRLFEQVQPHANTEGFQHLKAQQEEIKSIWGDVNADALERV
KMLNSALSHRRDLFSQADSLEAWMKKMQRKIAAGGDIYSDEIPETSAKLREIRSEFSQQD
PTLQMIQQEFRDMMQNCSEEEAAILSERLDRLLNNYSDMEDTIQKREQLCENWINFNDKQ
KEAQARLKALQARLASPDVKEDEVIQIKREIEMIKNGLQNWNQQSEPLDELMVNAKMTIK
DRATQRSLHFGSEVQGIANSCDNVMYEAERKEEHLGELHQLSDDFSDKKKQLIAKLGDLE
KKINSAKVNKSDLQGLKDLVSEIEDVRDEMYALNPEYEQFRELGRQIMQADVDKSPIVQT
QLNQVNEAWDRVQSLLGDKHQTYTSYVNLWMQYNDAKSGVNHVLDDIDPVVRQDIAFNNP
DDVKKSLDQHRNAGFELQANQTQLEHMNNKGLQLFDELKKLPNFNAQELVQDLDTMNHDW
ETANGIIEDHEKNLEAQLVCWDQINSGREEVASWLNGTMDKLGDSIKNFNDTASVESKLA
KYKEEAPYHKSVLEEITQKIADLKELNKNKPLPELERSQREMTEKFENATMLANQLDSTM
STFADEQKQLEKEMEEQSELLNEMRELMTKCDDLSGNDEDVVARYQALKESIELYCVWFV
DGEKRSNQEVQEKLLEKQRRIAAIQDKSAALQAKYPSAESASLVKDANTLSRKLETMLGR
ADRIEDSLKGTLEQRYIDAVNQEGRWLNSAKEKVMWCEDIGGDRYSVESKLDTIKELHGG
LAEGQQRKAATEEKLRLLRSILPRERLLELEGQNQQMEQEFQGLIGQIAQTQNKLETSID
QWSEYDGRYEKLAQWLKDMEARSRNESGLKPDTPSKKDQLEAYKDMLDEVQSHQNDFENL
KDAAYKISRTTGDNRTASYATQLYTRYKNLADNIKENVDKCEQNIDDHQQFLENEQEFKT
WLESADGLLNDCKKQGGDEESLNAKLQLVQNIVASKDQGLARFNRALESGEKLFPNTSNE
GRDVVRHELRGLRESWDRFNDNLNDTQRELDSSRMKWSTFDENYDQLTQWLAETEHQLGH
EPDVKNSLPEKKAQLQHLKTRCQDILSHKPMIDSISDKGTALSSAQVQTKLNKLNDKYNT
LCSFAKESVKNLENGVDEHEKYQDATQQCRDWMSVTNDKLAVCGEVGGDKKSLQNRLDRV
EDLKNSLKDGEAKVKNAHYHGEKAMQTTAPQGQATVQHELNTLTQDWENLVDRMGETQQG
LMHAIQAVDHYDGSCDNLNKWLREVEGEIKSVEYKSTLNDKENQLQKLKNLLRDVNEKQN
QFDEVQTMAATIPSSDGRLVNYSTQLVTRYDTAKSTLKDLIGKWEELCEEHQVYEGNYEE
CAEWLNTLQKRTDICSDLAGDKHDVEDRLVRLHELSAEKDQEASKIHQTIESGEKLYSTT
SSEGRDVIRQDLRALREQWENVCDRLSETNRKLDSSLNQWSSYDENSEKFHKWLIDMEVK
LKEDADLKTTLPDKKAQLQNHKILHQDILSRQYVMENLTKKANSLMHSTPSARVNKFVAE
LQKKYNKLCDTSKTILDTLDQSARDHQQYQDSYQDCQDWLNSSRDKIAACTDRSGDKMSL
QSKRERLREFVNSVPEGEKKLQNTLELGDVTAKNTSSQGREILKREIEHIQREWQDYLSL
IEMSETSLEQAMVQWGDFETKFDSCAAWLKNMEQQVKNYDLKSTVGEKQAHVEKLKKQRE
EILAHQPDIDRFTDDAQNLLHTSSDIRLSTQVSNLTNRYQGLLTLVKDLINKWEKFVIDH
QTYDNRIDDFNQWIMIEDQKLSSCQQPVSSQDSLEEKKTVLQMLFAEKEHGLQKLNSSIE
AGERLYPDTAGPGREKVRQELRTAKENWEQLFSGLNDAQRKVDTFLIQWSSYADGQESLQ
RWMSETESALRADVDMKNTLQEKRTQLQKHRSLLQDITSHQRMVDSVVEKAQGVLQTTSN
PDVASFITNINSRYEKLASDAKTLIARSEENVEVHQKYQDSLQTVVDWLSHMKDKQNMCG
DTTGDRHTIQNKLERLSELVTNLSDGVDRIKECETYAENTMNTTALKGRQGIQQELDVLH
LDWEDYKIKLSSLRDSLEQALYYWTLYEENYSKMSQWIKDLEKQVKDMPNRSTLDEKQES
LRKCQEIVQEVKGRQRDIDKFADDAQTLQNLTNEGRVGTFVSQLVTRYQNLLTNSKENVK
KCEQNVEDHKLFKEKLADCNQWLTKSRNKFNNCPDTGNSRAALEDSLEKVQDLLRDRDAG
FAKLNQVIESGEHLYPTTATEGREAIRQELRKLKLGFEGLYDDLSATQRKLEVSLVQWTS
FDDSHSQVDNWLRDMELQLHGSIPLRSTLEEKKTQLQNFKALHQDVLSYQRVIESIGDKA
QSLVHSSPDSDLNKFTSQTSSRYQKLCQASKDYVQQYEVLVSDHQQYNDAYNMCVEWLNS
IREKLSACADVSGDRHAIQNRLDKIQDILATKLEGEPKVNNVMKLAEKVLPNTAPQGKDI
IVRETDALREDWEAFMTALVKTKSDLEKCMDQWKEFETWHEKCASWLKDTEHKIREVDLK
ATLKEKITQLDKLKRLHEEIHGHQKDMDSLSDSAQDLLRLSTDTRVISQASQLSTKYQTL
QVNIKELIRRWEQYVIDHQSYSESFEHCKNWLIDMRSKINDVIETNGDKHTIQQRLTRVQ
DLLSAKEEGLHMLQIALDNLQVVLPNTSVTGRDNMRREMQQLQQEYDALSADLNESKMRQ
ESCLSQWTVYDDSTEQLERWLHDLEGQIQVESQPQNTLQEKKLQLERIKVLQLNINAQQS
TIDNLNEKAQTLKQMSHDSNLTNQIKQIVDRYDKLRTQVKDLLQNGEKYVRDHQIYCDVF
METSDWLTASIDRLSICSVVRGDRTVIEAQVHKVQDIHTTQEIGKKKLDNVLTKGKTVLP
QTSTQGQKLIQEEIDNLMKDFEHFQSDLKTSLDSLSNLSGKWQSYEEYYNELSKWIKDTE
TRMKTEADLCATLDQKHSQVLKQRSLHEEILNEQESFEKLGEQAQLLMQTSPDSRLSTQL
TQLTSRYSSLMSQSKELLKRYEQYLADHEQYDKVYDETVQWLSNTREKLAINTDVTGDKQ
KIQKQIDRLKEFVIMKEEGQMLIHTTNNWGEKTMTNTSVDGRESIRQDLQGLQQDWESLI
SDVTDTKVMLEARLLQWTDFDASLDGIQRWIKETEKKLKSSQLKGDISEKRNELQKIKVS
YQDIVSYEQMIESVNNKAVELEPSATGSRIVSDSSTLATKYNTLKEQAKDLLARNEQYVA
NHQDFLDACNNFNSWLRTAREKHATCSDTFGEKTSIESKIERSKSLMASLNEGAHRLAQA
NKAGEATLTSTSPSGQTKIRQELQAMNKEFEEYRNQLLHSQAELDNCHSRWEDFEHSYID
FNNWLKETESILRAEMEYKSTVEEKKQQWTQYQYHLDEVLSHQTSLDDVSEKAQALLQTN
ADAKTSHAITQLTTRYQSIIALAKDLVHCSENNYDNHVNYRERLQVFTEWLKDIKRKIKT
IEDDRGNRENVNIRLSQFDEIQNGMDQGHSYLRALLDACEKTLPSTNPRGCQSIRQESEK
AKVEYENLLTEMSQAKRNLENALTHWGDYDRLQDQLHDWLTDVEHRMMADPDLKNDLPEK
RSTLEKYKALLADILAHKDMMSRLEEKSGQVNDPTPQTRVAQLKARYQSVLNASKDLVSR
MGGQVELHEEYRKAYIACLDWLANNKHRLQRLSDYSGDKKTLQDRLLQLREFKSELKRGQ
EMVETAAGLGNQVCQQTAPRGQEVIQQEVKSLRDDWNMFASAVNDVEANLETSITNWSQL
NEEQESFLEWIEKKGREVKEQLEPTSNQFKKQQQLRRGEDLCDNITDNKVILEKVREKGD
AIAQRSSDPRLSNNMMQLSTKYQSLCSSAKNMVRKLRDNVDDHREYDDALNNGDKWLKWI
RDRVEACKDTSGDWNATQDRIDDIKDITANMDEGLQKVNHVCDLAERILPNTSMDGKKMV
EEQVTDLTNNWDKLNSSISEVTAMLEGVQQRWHDYEEYFGSLVRWLAEKESLLRSEPELK
ATLAEKKIQLDKYQMILTDIESHNRLINELADRVANLQALCDNPQIANSLSDVQQRFEAV
RNRCQDIVEMLQDRYDEHLLFHETQQDCEKWLLDTSFRLMSHNSLNVSTMELTERQIEKH
KAIVREITNYRSTMDHVNQIGQSLVLNNPNILKLAEQVQSQLQNLEQSYVNLQSTAQQIK
DRLQDILKKWQTYKKLLEKTEEYLTDDVVEWLEEAESNIPDSIDEAQQQREATQALLEKL
YERKQELAATAHTCENLGSMENLNQEETSLESPLNQFAGQVNQHMQETIAKVEKRLDRLR
DMMRQWEGVDRTRADLKQWLRNRQEEVADLENRPAKLHSEAAELDIDRLKGIRDEVEGRG
PAIDDLLSQYCDLTNHNDTIVDPAIRALKDDWEELLGQIDNLLADREHALNAARDLQEHQ
DSMDEDLANYVRELERIDQSDGNMTERSARLQQRTRRKCRATQTPTLASRGTPFDPFDSD
DDSYPKRPPFRRGNGNHSRTNLNLSSDRFSPSPRNGQFKTDPRTLNLSRDRSLYQSHDRS
FNNSRNFHDHSFRKGGAAAYLESESEESGYGDTFAETMNASSFDTQLNDTLSASIHLKET
IIVYDSDGEGSTDSYIEGYFAPTDPENMHDIGCQTPGHVRTQTDESLFAATPRSIQTQTP
RSRSRQNGDISMESIGSKKRKKKSSSRSDLLRSILSEVKDIKKQHGIDSDSVCDDNESVN
SETSIKKETLKSLYKDMKDLKSQGSQDNAATQTMSQQSTQTPFFPEGAEAYPSHHGNIQE
KLDEVRYLRSNRTTPSHLRGSHPSLLESPMEARYAGSSGTTPARFGSPTPMTSAPARAAN
PPPYGNANSPYQYADGHYSGTPVEPLPTPRMVTQDDLDAVQQRINRLQNYQISPNRSQPI
FREHRRLIPIGREYVQPRRLKLRQFTRSYDDMDLGDRRNASRRGHYMHRSRSDHTIMDRY
HLDDALAEAARTAKQLKKISSRMKHEFREDLRRYRY
Download sequence
Identical sequences V3ZYT9
XP_009063117.1.39240 jgi|Lotgi1|167389|fgenesh2_pg.C_sca_66000033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]