SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175905|fgenesh2_pg.C_sca_538000002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|175905|fgenesh2_pg.C_sca_538000002
Domain Number - Region: 185-261
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0144
Family MgtE N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175905|fgenesh2_pg.C_sca_538000002
Sequence length 275
Sequence
MTSLPSLMLVSSFSRLFCYLTRKRKNNVETTRPSYENIQQDVTRPSYENVQHDVTRLSYE
NEQQYVTRLSYENEQQYVTRLSYENIQHDVTRLSYENEQQDVTRLSYENEHQYVTRLSYE
NIQQDVTRPSYENIQQDVTRPSYENVQHDVTRLSYEKRNNNMLPDYHMRTNNNMLPDYHM
RTNTNMLPDFHMRIYNTMLPDLHMRMFNTMLPDLHMRIYNKMLPDLHMRIYNTMLPDLHM
RMFNTMLPDLHMKMYNTMLPDLHMRMFNTMLPDFI
Download sequence
Identical sequences V3ZZW1
jgi|Lotgi1|175905|fgenesh2_pg.C_sca_538000002 XP_009061104.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]