SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|217260|estExt_Genewise1Plus.C_sca_380065 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|217260|estExt_Genewise1Plus.C_sca_380065
Domain Number 1 Region: 224-474
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.52e-59
Family Decarboxylase 0.00000116
Further Details:      
 
Domain Number 2 Region: 12-203
Classification Level Classification E-value
Superfamily PRTase-like 8.13e-41
Family Phosphoribosyltransferases (PRTases) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|217260|estExt_Genewise1Plus.C_sca_380065
Sequence length 477
Sequence
MDVQANIDTEKLVLDLFEVEGVKFGNYTLKSGVQAPVYIDLRVVVSYPELMVRVSEMLWK
ASQNVKSEYKSICGVPYTALPLATCISAKENIPMLIRRKEAKGYGTKKLIEGKYNDGDNC
LIIEDVCTSGSSVLDTVQALKTCGIKVSDAIVLLDREQGAVDVLKQHGITLHSVMGLNQV
MEILERSKKIDCEMVEKVRSFLQVNRFTPSTNTQPCQPNQIKKLSFTERGKLCTNQMTKK
LFGIMEEKKSNLVVSADFTQSQQILELVDKVGPHVCMVKTHIDIVEDFSQDFITKLLQMA
QKHKFLLFEDRKYADIGNTVKLQYNNGIYHVSSWADIINAHCISGLGVLAALKQIGLEKN
KGCLLVAEMSSTGNMITAEYTAATVKLAEENKDFVIGFICQNRLSDDPTLLHLTPGVQLK
KGSDDLGQQYLTPEEVISKRGNDVIIVGRGITQSADVINTAIAYKQSAYNAYCQLLQ
Download sequence
Identical sequences V3ZKD1
XP_009057450.1.39240 jgi|Lotgi1|217260|estExt_Genewise1Plus.C_sca_380065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]