SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|230485|estExt_fgenesh2_pg.C_sca_120311 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|230485|estExt_fgenesh2_pg.C_sca_120311
Domain Number 1 Region: 9-222
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.02e-71
Family D-ribulose-5-phosphate 3-epimerase 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|230485|estExt_fgenesh2_pg.C_sca_120311
Sequence length 231
Sequence
MATSNGSSCRIAPSILNADLSSLTSECQRFMECGSDFLHLDVMDGHFVPNLTFGHPVVKC
LRPKLPNVCFEMHMMVQDPEKWVDPVADAGGNLYSFHYEATKDVDLCIRKIKEAGMKVGL
GINPPTDVNVVLPYIDKVDLILIMTVNPGFGGQKFMPECMSKVETLREKYKNLDIEVDGG
VGPDTIQQCADAGANVIVSGSAIIKNENPTEVVKYMRRVIDEAIQKHHLER
Download sequence
Identical sequences V4CL92
XP_009046520.1.39240 jgi|Lotgi1|230485|estExt_fgenesh2_pg.C_sca_120311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]