SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|53767|gw1.144.4.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|53767|gw1.144.4.1
Domain Number 1 Region: 224-349
Classification Level Classification E-value
Superfamily Plus3-like 1.96e-42
Family Plus3 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|53767|gw1.144.4.1
Sequence length 586
Sequence
VKKTRRSTAISSSDSEAEKEKSASEPEEGEVSDSGSGSASGDESGSDDEKFVDGYDENLI
GDEEDKKMLEQMTEKEREQELFNRMERRAVLKTRFEIEKKLKKAKKKEKNKKSKSSGSSD
SPYQLKSVSDRSKERRKDIESKKDSKKTSALELLRLQREEKKNKEEKVKEKQKKTLKISE
IYSDDDDEDDDDDNDDSDSDASERSSDYSDDDYKPKKVVPVSKKEEICKIRLSRHKMEKW
CHMPYFKKTVVGAFVRIGIGNHDGRAIYRVAEIIDVVETAKIYQLGTTRTNKGLKLRHGA
AERVYRLEFVSNQDFTDTEFDKWKEAVMLNGSQLPTVDEIEKKLLEIKNVGSFQFKDEDI
KTIVAEKQRFRKNPHNYALKKTQLMKQKEQAEIAGNQAAVNSAKQELEELEDRATKLDRK
RTSTINSISFINQRNRQNNIIAAEKAFKVEVAAAKIAAADPFTRRQCRPTLVTKASGKFP
EMAVPTKVGNTAAEKAGSLMPAPVLGELTSLDDLVSDRSQSTSKSSDKKDIEDVFAVHDF
DIKLDLDVPATNPTMVMASRAPQPVRDITPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences V4AUJ5
jgi|Lotgi1|53767|gw1.144.4.1 XP_009048349.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]