SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|133011|e_gw1.82.17.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|133011|e_gw1.82.17.1
Domain Number 1 Region: 253-465
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000425
Family Tropomyosin 0.0062
Further Details:      
 
Domain Number 2 Region: 402-624
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000501
Family Tropomyosin 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|133011|e_gw1.82.17.1
Domain Number - Region: 7-152
Classification Level Classification E-value
Superfamily Tropomyosin 0.0193
Family Tropomyosin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|133011|e_gw1.82.17.1
Sequence length 726
Sequence
QIKMLDGERSKLGKEVVELQTRVAHDEEKDEESRRFSFDLKQKVVETEASREALRKELAN
MQRKMAELIDEAHLKEKNYHMLLEDSRRNEAKLDDNRNELEHALDNCNAEIKDLRLKLSG
SEGRVNALEAALARLEGTKRDIEFKLNSIVSSLRRSIGFRQEMPRGRAMRTRSPSPRRSR
SRPTSPSKGFESTYTTTTDGRGTPIPRTGVSPVRGESPVRSRGASPVRFVDMSAVDVDPE
AVRMALRDFMGQLANAERERDDAISSVNSLTTQLRDLEGDHERTENRLSTLQKSMGAIEE
DKRGIDGRLSSAQTALMLQEETIRRNERERKTMSDKCIALERNLTAVESEKRQLEEKLSK
MRTNESKLEDDKKNLKIAFDDAENRCTKLELSRRALEGELQRVKLAMNDKETENQVLSNR
VDNLMKQVQDLESKSNSLQLTIDRMSLNLTKTEEEGHHHKDKVQALSMSLSDSNAVISEL
EDRISQMQRAITNSEHDRRVLQERLEQTRQALDDAKKQNQNLLERMQGLQSDLSESDVRR
SELEGHVRQSSTILVQRQESEQELNQKIQKLQQDKQNLADKVTQLQRTISDMENAKHEVE
RSATRLEKDKSALRNTLDKVERERLRSEEMANKSVLERGNLDIVMQRLEDDNVELQRQVQ
QLQAQLAEAEQQHSQRLIDLTTRHRAETEMETDRLRQSQTQAERLLDARERSNRQRIKGL
EEQVSL
Download sequence
Identical sequences V3ZHG3
XP_009065671.1.39240 jgi|Lotgi1|133011|e_gw1.82.17.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]